The best Anti-Ferritin, Recombinant Human NUDT1 Protein Heavy Polypeptide
(FTH)-Rabbit polyclonal Antibody products,
quick delivery, high quality.

Back to: Our Providers / fitzgerald / NELF antibody

Size

50 µg

Price

475.00

Catalog

70R-2570

Quick and safe buy process

Additional Information

This is a rabbit polyclonal antibody against NELF, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com

Type of Immunogen

NELF antibodies were raised using the N terminal of NELF corresponding to a region with amino acids GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA

Assay Information

NELF Blocking Peptide, catalog no. 33R-3145, is also available for use as a blocking control in assays to test for specificity of this NELF antibody

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NELF antibody in PBS

Specificity

NELF antibody was raised against the N terminal of NELF

Antibody Subtype

Polyclonal Antibodies, Purified

Method of Purification

Affinity purified

Category

Primary Antibody

Cross Reactivity

Human,Mouse,Rat

Area of research

Neuroscience

Usage Recommendations

WB: 1 ug/ml

French translation

anticorps

Shipping conditions

Blue Ice

Concentration

1 mg/ml

Raised in

Rabbit

Tested for

WB

Simply order proccess

Just click and buy.