The best Anti-Ferritin, Recombinant Human NUDT1 Protein Heavy Polypeptide
(FTH)-Rabbit polyclonal Antibody products,
quick delivery, high quality.
Back to: Our Providers / novo / Recombinant Human Parathyroid Hormone 1 Receptor/PTH1R (Glu49, C-6His)
Size
500 ug
Price
1116.00
Catalog
CJ55-500
Quick and safe buy process
Additional description
Hormone releasing factors and releasing hormones are signaling molecules produced by glands in multicellular organisms. The glands that secrete Luteinizing hormones LHRG and LH, FSH comprise the endocrine signaling system. The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine or intracrine signaling) or nearby cells (paracrine signaling). Human recombinant LHRG and GHRH are produced in E. coli or in yeast cells.The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Description
Recombinant Human Parathyroid hormone 1 receptor is produced by our Mammalian expression system and the target gene encoding Tyr23-Met189 is expressed with a 6His tag at the C-terminus.
Peptide sequence
YALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMVDHHHHHH
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Package form
Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Reconstitution conditions
See included datasheet or contact us for more information.
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Source
Recombinants or rec. proteins
Shipping condition
Ambient/Room Temperature
Group
recombinants
Origin
Human cells
Estimated molecular weight
20,3 kDa
UniProt number
Q03431
Species reactivity
Human