The best Anti-Ferritin, Recombinant Human NUDT1 Protein Heavy Polypeptide
(FTH)-Rabbit polyclonal Antibody products,
quick delivery, high quality.

Back to: Our Providers / novo / Recombinant Human Parathyroid Hormone/PTH (N-8His)

Size

500 ug

Price

1116.00

Catalog

CB42-500

Quick and safe buy process

Additional description

Hormone releasing factors and releasing hormones are  signaling molecules produced by glands in multicellular organisms. The glands that secrete Luteinizing hormones LHRG and LH, FSH comprise the endocrine signaling system. The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine or intracrine signaling) or nearby cells (paracrine signaling). Human recombinant LHRG and GHRH are produced in E. coli or in yeast cells.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Description

Recombinant Human Parathyroid Hormone is produced by our Mammalian expression system and the target gene encoding Ser32-Gln115 is expressed with a 8His tag at the N-terminus.

Peptide sequence

HHHHHHHHSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.

Reconstitution conditions

See included datasheet or contact us for more information.

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Source

Recombinants or rec. proteins

Shipping condition

Ambient/Room Temperature

Group

recombinants

Origin

Human cells

Estimated molecular weight

10,5 kDa

UniProt number

P01270

Species reactivity

Human

Simply order proccess

Just click and buy.