Quick contact, quick delivery Anti-Cytohesin 1 (CYTH1)-Rabbit polyclonal
Antibody, BSA Conjugated Parathyroid Hormone (PTH) products,
greatests prices.

Back to: Our Providers / novo / Recombinant Human Parathyroid Hormone 1 Receptor/PTH1R (Gly49, C-6His)

Size

500 ug

Price

1614.00

Catalog

C766-500

Quick and safe buy process

Additional description

Hormone releasing factors and releasing hormones are  signaling molecules produced by glands in multicellular organisms. The glands that secrete Luteinizing hormones LHRG and LH, FSH comprise the endocrine signaling system. The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine or intracrine signaling) or nearby cells (paracrine signaling). Human recombinant LHRG and GHRH are produced in E. coli or in yeast cells.The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Description

Recombinant Human Parathyroid hormone 1 receptor is produced by our Mammalian expression system and the target gene encoding Tyr23-Met189 is expressed with a 6His tag at the C-terminus.

Peptide sequence

YALVDADDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMVDHHHHHH

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Source

Recombinants or rec. proteins

Shipping condition

Ambient/Room Temperature

Group

recombinants

Origin

Human cells

Estimated molecular weight

20,2 kDa

UniProt number

Q0VGD7

Species reactivity

Human

Simply order proccess

Just click and buy.