The best quality, top Parathyroid Hormone, aa1-34, Human (PTH), Parathyroid Hormone,
NT, aa1-34 Concentrated (PTH) products prices, the best delivery.
Back to: Our Providers / novo / Recombinant Human Parathyroid Hormone/Parathormone/PTH (1-84)
Size
10 ug
Price
157.00
Catalog
C010-10
Quick and safe buy process
Additional description
Hormone releasing factors and releasing hormones are signaling molecules produced by glands in multicellular organisms. The glands that secrete Luteinizing hormones LHRG and LH, FSH comprise the endocrine signaling system. The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine or intracrine signaling) or nearby cells (paracrine signaling). Human recombinant LHRG and GHRH are produced in E. coli or in yeast cells.
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Description
Recombinant Human Parathyroid Hormone is produced by our E.coli expression system and the target gene encoding Ser32-Gln115 is expressed.
Package form
Lyophilized from a 0.2 µm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 5% Mannitol, pH 4.0.
Peptide sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Reconstitution conditions
See included datasheet or contact us for more information.
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Source
Recombinants or rec. proteins
Shipping condition
Ambient/Room Temperature
Origin
Escherichia coli
Group
recombinants
UniProt number
P01270
Species reactivity
Human
Estimated molecular weight
9 kDa