Th1 Response

Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

You can block the antibody by the specific target amino acid sequence of peptide.

Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS

Blocking Peptides

blocking peptide

Cell Biology

Synthetic

Proteins

Blue Ice

WB, IHC